Lineage for d1vbrb_ (1vbr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833217Species Thermotoga maritima [TaxId:2336] [186796] (4 PDB entries)
  8. 2833224Domain d1vbrb_: 1vbr B: [119962]
    Other proteins in same PDB: d1vbra1
    automated match to d1xyza_
    complexed with acy

Details for d1vbrb_

PDB Entry: 1vbr (more details), 1.8 Å

PDB Description: crystal structure of complex xylanase 10b from thermotoga maritima with xylobiose
PDB Compounds: (B:) endo-1,4-beta-xylanase B

SCOPe Domain Sequences for d1vbrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbrb_ c.1.8.0 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
vslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdry
nftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfk
grvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysieein
aksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitemdv
riplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygkallf
denynpkpcyyaikevlekkieer

SCOPe Domain Coordinates for d1vbrb_:

Click to download the PDB-style file with coordinates for d1vbrb_.
(The format of our PDB-style files is described here.)

Timeline for d1vbrb_: