Lineage for d1vbra1 (1vbr A:517-840)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831084Protein Xylanase [51488] (6 species)
  7. 2831119Species Thermotoga maritima [TaxId:2336] [141772] (1 PDB entry)
    Uniprot Q9WXS5 23-346
  8. 2831120Domain d1vbra1: 1vbr A:517-840 [119961]
    Other proteins in same PDB: d1vbrb_
    complexed with acy

Details for d1vbra1

PDB Entry: 1vbr (more details), 1.8 Å

PDB Description: crystal structure of complex xylanase 10b from thermotoga maritima with xylobiose
PDB Compounds: (A:) endo-1,4-beta-xylanase B

SCOPe Domain Sequences for d1vbra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbra1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]}
vslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdry
nftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfk
grvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysieein
aksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitemdv
riplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygkallf
denynpkpcyyaikevlekkieer

SCOPe Domain Coordinates for d1vbra1:

Click to download the PDB-style file with coordinates for d1vbra1.
(The format of our PDB-style files is described here.)

Timeline for d1vbra1: