![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Xylanase [51488] (6 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [141772] (1 PDB entry) Uniprot Q9WXS5 23-346 |
![]() | Domain d1vbra1: 1vbr A:517-840 [119961] Other proteins in same PDB: d1vbrb_ complexed with acy |
PDB Entry: 1vbr (more details), 1.8 Å
SCOPe Domain Sequences for d1vbra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbra1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} vslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdry nftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfk grvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysieein aksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitemdv riplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygkallf denynpkpcyyaikevlekkieer
Timeline for d1vbra1: