Lineage for d1vbkb1 (1vbk B:176-307)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2469527Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2469798Family c.26.2.6: ThiI-like [142093] (2 proteins)
    Pfam PF02568
  6. 2469799Protein Hypothetical protein PH1313, C-terminal domain [142096] (1 species)
    overal structure is similar to ThiI
  7. 2469800Species Pyrococcus horikoshii [TaxId:53953] [142097] (1 PDB entry)
    Uniprot O59053 176-307
  8. 2469802Domain d1vbkb1: 1vbk B:176-307 [119959]
    Other proteins in same PDB: d1vbka2, d1vbkb2
    automated match to d1vbka1
    complexed with mrd

Details for d1vbkb1

PDB Entry: 1vbk (more details), 1.9 Å

PDB Description: Crystal structure of PH1313 from Pyrococcus horikoshii Ot3
PDB Compounds: (B:) hypothetical protein PH1313

SCOPe Domain Sequences for d1vbkb1:

Sequence, based on SEQRES records: (download)

>d1vbkb1 c.26.2.6 (B:176-307) Hypothetical protein PH1313, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
igtegrmigilhdelsalaiflmmkrgvevipvyigkddknlekvrslwnllkrysygsk
gflvvaesfdrvlklirdfgvkgvikglrpndlnsevseitedfkmfpvpvyyplialpe
eyiksvkerlgl

Sequence, based on observed residues (ATOM records): (download)

>d1vbkb1 c.26.2.6 (B:176-307) Hypothetical protein PH1313, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
igtegrmigilhdelsalaiflmmkrgvevipvyigkddknlekvrslwnllkrysygsk
gflvvaesfdrvlklirdfgvkgvikglrpvseitedfkmfpvpvyyplialpeeyiksv
kerlgl

SCOPe Domain Coordinates for d1vbkb1:

Click to download the PDB-style file with coordinates for d1vbkb1.
(The format of our PDB-style files is described here.)

Timeline for d1vbkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vbkb2