SCOP 1.73: Domain d1vbkb1: 1vbk B:176-307

Lineage for d1vbkb1 (1vbk B:176-307)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.6: ThiI-like [142093] (2 proteins)
   Pfam PF02568

6. Protein Hypothetical protein PH1313, C-terminal domain [142096] (1 species)
   overal structure is similar to ThiI

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [142097] (1 PDB entry)

8. Domain d1vbkb1: 1vbk B:176-307 [119959]
   Other proteins in same PDB: d1vbka2, d1vbkb2
   automatically matched to 1VBK A:176-307
   complexed with mrd

Details for d1vbkb1

PDB Entry: 1vbk, 1.9 Å

PDB Description: Crystal structure of PH1313 from Pyrococcus horikoshii Ot3

PDB Compounds: (B:) hypothetical protein PH1313

SCOP Domain Sequences for d1vbkb1:

Sequence, based on SEQRES records:

>d1vbkb1 c.26.2.6 (B:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
igtegrmigilhdelsalaiflmmkrgvevipvyigkddknlekvrslwnllkrysygsk
gflvvaesfdrvlklirdfgvkgvikglrpndlnsevseitedfkmfpvpvyyplialpe
eyiksvkerlgl

Sequence, based on observed residues (ATOM records):

>d1vbkb1 c.26.2.6 (B:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
igtegrmigilhdelsalaiflmmkrgvevipvyigkddknlekvrslwnllkrysygsk
gflvvaesfdrvlklirdfgvkgvikglrpvseitedfkmfpvpvyyplialpeeyiksv
kerlgl

Timeline for d1vbkb1:

• d1vbkb1 is new in SCOP 1.73
  
• d1vbkb1 appears in SCOP 1.75
  
• d1vbkb1 appears in the current release, SCOPe 2.08