Lineage for d1vbka2 (1vbk A:1-175)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882345Fold d.308: THUMP domain [143436] (1 superfamily)
    contains mixed 8-stranded beta-sheet, folded into a half-barrel and covered with 4 helices on the outside; order 32148756; strands 5, 6 and 7 are parallel
  4. 882346Superfamily d.308.1: THUMP domain-like [143437] (3 families) (S)
    predicted RNA-binding function
  5. 882347Family d.308.1.1: THUMP domain [143438] (2 proteins)
    Pfam PF02926
  6. 882348Protein Hypothetical protein PH1313, N-terminal domain [143441] (1 species)
  7. 882349Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143442] (1 PDB entry)
    Uniprot O59053 1-175
  8. 882350Domain d1vbka2: 1vbk A:1-175 [119958]
    Other proteins in same PDB: d1vbka1, d1vbkb1
    complexed with mrd

Details for d1vbka2

PDB Entry: 1vbk (more details), 1.9 Å

PDB Description: Crystal structure of PH1313 from Pyrococcus horikoshii Ot3
PDB Compounds: (A:) hypothetical protein PH1313

SCOP Domain Sequences for d1vbka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbka2 d.308.1.1 (A:1-175) Hypothetical protein PH1313, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mnvvivrygeigtksrqtrswfekilmnnirealvteevpykeifsrhgriivktnspke
aanvlvrvfgivsispameveaslekinrtallmfrkkakevgkerpkfrvtarritkef
pldsleiqakvgeyilnnencevdlknydieigieimqgkayiytekikgwgglp

SCOP Domain Coordinates for d1vbka2:

Click to download the PDB-style file with coordinates for d1vbka2.
(The format of our PDB-style files is described here.)

Timeline for d1vbka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vbka1