Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.6: ThiI-like [142093] (2 proteins) Pfam PF02568 |
Protein Hypothetical protein PH1313, C-terminal domain [142096] (1 species) overal structure is similar to ThiI |
Species Pyrococcus horikoshii [TaxId:53953] [142097] (1 PDB entry) Uniprot O59053 176-307 |
Domain d1vbka1: 1vbk A:176-307 [119957] Other proteins in same PDB: d1vbka2, d1vbkb2 complexed with mrd |
PDB Entry: 1vbk (more details), 1.9 Å
SCOPe Domain Sequences for d1vbka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} igtegrmigilhdelsalaiflmmkrgvevipvyigkddknlekvrslwnllkrysygsk gflvvaesfdrvlklirdfgvkgvikglrpndlnsevseitedfkmfpvpvyyplialpe eyiksvkerlgl
Timeline for d1vbka1: