SCOP 1.75: Domain d1vbka1: 1vbk A:176-307

Lineage for d1vbka1 (1vbk A:176-307)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.6: ThiI-like [142093] (2 proteins)
   Pfam PF02568

6. Protein Hypothetical protein PH1313, C-terminal domain [142096] (1 species)
   overal structure is similar to ThiI

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [142097] (1 PDB entry)
   Uniprot O59053 176-307

8. Domain d1vbka1: 1vbk A:176-307 [119957]
   Other proteins in same PDB: d1vbka2, d1vbkb2
   complexed with mrd

Details for d1vbka1

PDB Entry: 1vbk, 1.9 Å

PDB Description: Crystal structure of PH1313 from Pyrococcus horikoshii Ot3

PDB Compounds: (A:) hypothetical protein PH1313

SCOP Domain Sequences for d1vbka1:

Sequence; same for both SEQRES and ATOM records:

>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
igtegrmigilhdelsalaiflmmkrgvevipvyigkddknlekvrslwnllkrysygsk
gflvvaesfdrvlklirdfgvkgvikglrpndlnsevseitedfkmfpvpvyyplialpe
eyiksvkerlgl

Timeline for d1vbka1:

• d1vbka1 first appeared in SCOP 1.73
  
• d1vbka1 appears in SCOPe 2.01
  
• d1vbka1 appears in the current release, SCOPe 2.08