Lineage for d1vbka1 (1vbk A:176-307)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693721Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 693920Family c.26.2.6: ThiI-like [142093] (2 proteins)
    Pfam PF02568
  6. 693921Protein Hypothetical protein PH1313, C-terminal domain [142096] (1 species)
    overal structure is similar to ThiI
  7. 693922Species Archaeon Pyrococcus horikoshii [TaxId:53953] [142097] (1 PDB entry)
  8. 693923Domain d1vbka1: 1vbk A:176-307 [119957]
    Other proteins in same PDB: d1vbka2, d1vbkb2
    complexed with mrd

Details for d1vbka1

PDB Entry: 1vbk (more details), 1.9 Å

PDB Description: Crystal structure of PH1313 from Pyrococcus horikoshii Ot3
PDB Compounds: (A:) hypothetical protein PH1313

SCOP Domain Sequences for d1vbka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
igtegrmigilhdelsalaiflmmkrgvevipvyigkddknlekvrslwnllkrysygsk
gflvvaesfdrvlklirdfgvkgvikglrpndlnsevseitedfkmfpvpvyyplialpe
eyiksvkerlgl

SCOP Domain Coordinates for d1vbka1:

Click to download the PDB-style file with coordinates for d1vbka1.
(The format of our PDB-style files is described here.)

Timeline for d1vbka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vbka2