Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) contains barrel, closed, n=7, S=10 |
Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein) |
Protein Pyruvate phosphate dikinase, central domain [52011] (3 species) |
Species Maize (Zea mays) [TaxId:4577] [141971] (2 PDB entries) Uniprot P11155 454-588 |
Domain d1vbga2: 1vbg A:383-517 [119952] Other proteins in same PDB: d1vbga1, d1vbga3 complexed with mg, so4 |
PDB Entry: 1vbg (more details), 2.3 Å
SCOPe Domain Sequences for d1vbga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbga2 c.8.1.1 (A:383-517) Pyruvate phosphate dikinase, central domain {Maize (Zea mays) [TaxId: 4577]} qfenpsaykdqviatglpaspgaavgqvvftaedaeawhsqgkaailvraetspedvggm haavgilterggmtshaavvargwgkccvsgcsgirvndaeklvtigghvlregewlsln gstgevilgkqplsp
Timeline for d1vbga2: