SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1vbga1 (1vbg A:521-876)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088170Family c.1.12.2: Pyruvate phosphate dikinase, C-terminal domain [51629] (1 protein)
    automatically mapped to Pfam PF02896
  6. 2088171Protein Pyruvate phosphate dikinase, C-terminal domain [51630] (3 species)
  7. 2088180Species Maize (Zea mays) [TaxId:4577] [141848] (2 PDB entries)
    Uniprot P11155 592-947
  8. 2088181Domain d1vbga1: 1vbg A:521-876 [119951]
    Other proteins in same PDB: d1vbga2, d1vbga3
    complexed with mg, so4

Details for d1vbga1

PDB Entry: 1vbg (more details), 2.3 Å

PDB Description: Pyruvate Phosphate Dikinase from Maize
PDB Compounds: (A:) pyruvate,orthophosphate dikinase

SCOPe Domain Sequences for d1vbga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbga1 c.1.12.2 (A:521-876) Pyruvate phosphate dikinase, C-terminal domain {Maize (Zea mays) [TaxId: 4577]}
sgdlgtfmawvddvrklkvlanadtpddaltarnngaqgiglcrtehmffasderikavr
qmimaptlelrqqaldrllpyqrsdfegiframdglpvtirlldpplheflpegniediv
selcaetganqedalarieklsevnpmlgfrgcrlgisypeltemqaraifeaaiamtnq
gvqvfpeimvplvgtpqelghqvtlirqvaekvfanvgktigykvgtmieipraalvade
iaeqaeffsfgtndltqmtfgysrddvgkfipvylaqgilqhdpfevldqrgvgelvkfa
tergrkarpnlkvgicgehggepssvaffakagldyvscspfrvpiarlaaaqvlv

SCOPe Domain Coordinates for d1vbga1:

Click to download the PDB-style file with coordinates for d1vbga1.
(The format of our PDB-style files is described here.)

Timeline for d1vbga1: