Lineage for d1vb9b2 (1vb9 B:503-585)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2077149Protein Maltogenic amylase [51031] (4 species)
  7. 2077163Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)
  8. 2077167Domain d1vb9b2: 1vb9 B:503-585 [119949]
    Other proteins in same PDB: d1vb9a1, d1vb9a3, d1vb9b1, d1vb9b3
    automated match to d1jl8a2
    complexed with ca

Details for d1vb9b2

PDB Entry: 1vb9 (more details), 2.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) complexed with transglycosylated product
PDB Compounds: (B:) alpha-amylase II

SCOPe Domain Sequences for d1vb9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vb9b2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOPe Domain Coordinates for d1vb9b2:

Click to download the PDB-style file with coordinates for d1vb9b2.
(The format of our PDB-style files is described here.)

Timeline for d1vb9b2: