Lineage for d1vb9a3 (1vb9 A:121-502)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682153Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 682482Protein Maltogenic amylase, central domain [51465] (4 species)
    contains an additional N-terminal domain
  7. 682497Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (16 PDB entries)
  8. 682502Domain d1vb9a3: 1vb9 A:121-502 [119947]
    Other proteins in same PDB: d1vb9a1, d1vb9a2, d1vb9b1, d1vb9b2
    automatically matched to d1bvza3
    complexed with ca, glc; mutant

Details for d1vb9a3

PDB Entry: 1vb9 (more details), 2.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) complexed with transglycosylated product
PDB Compounds: (A:) alpha-amylase II

SCOP Domain Sequences for d1vb9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vb9a3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

SCOP Domain Coordinates for d1vb9a3:

Click to download the PDB-style file with coordinates for d1vb9a3.
(The format of our PDB-style files is described here.)

Timeline for d1vb9a3: