Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins) |
Protein Direct oxygen sensor protein, DOS [111118] (1 species) Heme-regulated cyclic AMP phosphodiesterase; formerly hypothetical protein YddU |
Species Escherichia coli [TaxId:562] [111119] (5 PDB entries) Uniprot P76129 8-126 ! Uniprot P76129 12-124 |
Domain d1vb6b1: 1vb6 B:20-133 [119944] automatically matched to d1s66l_ complexed with hem, oxy |
PDB Entry: 1vb6 (more details), 1.56 Å
SCOPe Domain Sequences for d1vb6b1:
Sequence, based on SEQRES records: (download)
>d1vb6b1 d.110.3.2 (B:20-133) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrda
>d1vb6b1 d.110.3.2 (B:20-133) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe yirhnreggegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrda
Timeline for d1vb6b1: