Lineage for d1vb6b1 (1vb6 B:20-133)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731578Fold d.110: Profilin-like [55769] (9 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 731664Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 731715Family d.110.3.2: Heme-binding PAS domain [55789] (2 proteins)
  6. 731716Protein Direct oxygen sensor protein, DOS [111118] (1 species)
    Heme-regulated cyclic AMP phosphodiesterase; formerly hypothetical protein YddU
  7. 731717Species Escherichia coli [TaxId:562] [111119] (5 PDB entries)
  8. 731723Domain d1vb6b1: 1vb6 B:20-133 [119944]
    automatically matched to d1s66l_
    complexed with hem, oxy

Details for d1vb6b1

PDB Entry: 1vb6 (more details), 1.56 Å

PDB Description: Crystal Structure of the heme PAS sensor domain of Ec DOS (oxygen-bound form)
PDB Compounds: (B:) Heme pas sensor protein

SCOP Domain Sequences for d1vb6b1:

Sequence, based on SEQRES records: (download)

>d1vb6b1 d.110.3.2 (B:20-133) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrda

Sequence, based on observed residues (ATOM records): (download)

>d1vb6b1 d.110.3.2 (B:20-133) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnreggegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrda

SCOP Domain Coordinates for d1vb6b1:

Click to download the PDB-style file with coordinates for d1vb6b1.
(The format of our PDB-style files is described here.)

Timeline for d1vb6b1: