SCOPe 2.04: Domain d1vb6a_: 1vb6 A:

Lineage for d1vb6a_ (1vb6 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)

6. Protein Direct oxygen sensor protein, DOS [111118] (1 species)
   Heme-regulated cyclic AMP phosphodiesterase; formerly hypothetical protein YddU

7. Species Escherichia coli [TaxId:562] [111119] (5 PDB entries)
   Uniprot P76129 8-126 ! Uniprot P76129 12-124

8. Domain d1vb6a_: 1vb6 A: [119943]
   automated match to d1v9ya_
   complexed with hem, oxy

Details for d1vb6a_

PDB Entry: 1vb6, 1.56 Å

PDB Description: Crystal Structure of the heme PAS sensor domain of Ec DOS (oxygen-bound form)

PDB Compounds: (A:) Heme pas sensor protein

SCOPe Domain Sequences for d1vb6a_:

Sequence; same for both SEQRES and ATOM records:

>d1vb6a_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrda

Timeline for d1vb6a_:

• d1vb6a_ first appeared in SCOP 1.73, called d1vb6a1
  
• d1vb6a_ appears in SCOPe 2.03
  
• d1vb6a_ appears in SCOPe 2.05
  
• d1vb6a_ appears in the current release, SCOPe 2.08