Lineage for d1vb3a1 (1vb3 A:1-428)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2156900Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2157052Protein Threonine synthase [64172] (4 species)
  7. 2157056Species Escherichia coli [TaxId:562] [142748] (1 PDB entry)
    Uniprot P00934 1-428
  8. 2157057Domain d1vb3a1: 1vb3 A:1-428 [119942]
    complexed with kpa, so4

Details for d1vb3a1

PDB Entry: 1vb3 (more details), 2.2 Å

PDB Description: Crystal Structure of Threonine Synthase from Escherichia coli
PDB Compounds: (A:) threonine synthase

SCOPe Domain Sequences for d1vb3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vb3a1 c.79.1.1 (A:1-428) Threonine synthase {Escherichia coli [TaxId: 562]}
mklynlkdhneqvsfaqavtqglgknqglffphdlpefslteidemlkldfvtrsakils
afigdeipqeileervraafafpapvanvesdvgclelfhgptlafkdfggrfmaqmlth
iagdkpvtiltatsgdtgaavahafyglpnvkvvilyprgkisplqeklfctlggnietv
aidgdfdacqalvkqafddeelkvalglnsansinisrllaqicyyfeavaqlpqetrnq
lvvsvpsgnfgdltagllakslglpvkrfiaatnvndtvprflhdgqwspkatqatlsna
mdvsqpnnwprveelfrrkiwqlkelgyaavddettqqtmrelkelgytsephaavayra
lrdqlnpgeyglflgtahpakfkesveailgetldlpkelaeradlpllshnlpadfaal
rklmmnhq

SCOPe Domain Coordinates for d1vb3a1:

Click to download the PDB-style file with coordinates for d1vb3a1.
(The format of our PDB-style files is described here.)

Timeline for d1vb3a1: