Lineage for d1vayf2 (1vay F:11-141)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. Protein Urate oxidase (uricase) [55634] (3 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. Species Arthrobacter globiformis [TaxId:1665] [143630] (2 PDB entries)
  8. Domain d1vayf2: 1vay F:11-141 [119937]
    automated match to d1vaxa2
    complexed with aza

Details for d1vayf2

PDB Entry: 1vay (more details), 2.24 Å

PDB Description: Crystal Structure of Uricase from Arthrobacter globiformis with inhibitor 8-azaxanthine
PDB Compounds: (F:) Uric acid oxidase

SCOPe Domain Sequences for d1vayf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vayf2 d.96.1.4 (F:11-141) Urate oxidase (uricase) {Arthrobacter globiformis [TaxId: 1665]}
tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
evrtavleisg

SCOPe Domain Coordinates for d1vayf2 are not available.

Timeline for d1vayf2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vayf1
View in 3D
Domains from other chains:
(mouse over for more information)
d1vaya1, d1vaya2, d1vayb1, d1vayb2, d1vayc1, d1vayc2, d1vayd1, d1vayd2, d1vaye1, d1vaye2, d1vayg1, d1vayg2, d1vayh1, d1vayh2