Lineage for d1vaha2 (1vah A:1-408)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093019Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2093517Protein automated matches [190099] (25 species)
    not a true protein
  7. 2093628Species Pig (Sus scrofa) [TaxId:9823] [225875] (3 PDB entries)
  8. 2093631Domain d1vaha2: 1vah A:1-408 [119906]
    Other proteins in same PDB: d1vaha1
    automated match to d1jxka2
    complexed with ca, cl, npo

Details for d1vaha2

PDB Entry: 1vah (more details), 2.4 Å

PDB Description: crystal structure of the pig pancreatic-amylase complexed with r- nitrophenyl-a-d-maltoside
PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1vaha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vaha2 c.1.8.1 (A:1-408) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
pgnrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggasiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgepfan

SCOPe Domain Coordinates for d1vaha2:

Click to download the PDB-style file with coordinates for d1vaha2.
(The format of our PDB-style files is described here.)

Timeline for d1vaha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vaha1