Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Down syndrome cell adhesion molecule-like protein 1, DSCAML1 [141055] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141056] (1 PDB entry) Uniprot Q8TD84 979-1087 |
Domain d1va9a1: 1va9 A:8-116 [119904] Other proteins in same PDB: d1va9a2, d1va9a3 |
PDB Entry: 1va9 (more details)
SCOPe Domain Sequences for d1va9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} isteeaapdgppmdvtlqpvtsqsiqvtwkapkkelqngvirgyqigyrenspgsngqys ivemkatgdsevytldnlkkfaqygvvvqafnragtgpssseinattle
Timeline for d1va9a1: