![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein Maguk p55 subfamily member 5 [141275] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [141276] (1 PDB entry) Uniprot Q9JLB2 236-335 Structure of the second L27 domain is known (101293) |
![]() | Domain d1va8a1: 1va8 A:8-107 [119903] Other proteins in same PDB: d1va8a2, d1va8a3 |
PDB Entry: 1va8 (more details)
SCOPe Domain Sequences for d1va8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} pitdervyesighyggetvkivriekardiplgatvrnemdsviisrivkggaaeksgll hegdevleingieirgkdvnevfdllsdmhgtltfvlips
Timeline for d1va8a1: