Lineage for d1va8a1 (1va8 A:8-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785983Protein Maguk p55 subfamily member 5 [141275] (1 species)
  7. 2785984Species Mouse (Mus musculus) [TaxId:10090] [141276] (1 PDB entry)
    Uniprot Q9JLB2 236-335
    Structure of the second L27 domain is known (101293)
  8. 2785985Domain d1va8a1: 1va8 A:8-107 [119903]
    Other proteins in same PDB: d1va8a2, d1va8a3

Details for d1va8a1

PDB Entry: 1va8 (more details)

PDB Description: solution structure of the pdz domain of pals1 protein
PDB Compounds: (A:) MAGUK p55 subfamily member 5

SCOPe Domain Sequences for d1va8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]}
pitdervyesighyggetvkivriekardiplgatvrnemdsviisrivkggaaeksgll
hegdevleingieirgkdvnevfdllsdmhgtltfvlips

SCOPe Domain Coordinates for d1va8a1:

Click to download the PDB-style file with coordinates for d1va8a1.
(The format of our PDB-style files is described here.)

Timeline for d1va8a1: