Lineage for d1va0b1 (1va0 B:2-226)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710141Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 710142Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family) (S)
  5. 710143Family c.90.1.1: Tetrapyrrole methylase [53791] (7 proteins)
    Pfam PF00590
  6. 710161Protein Hypothetical protein TTHA0667 [142781] (1 species)
    strong sequence similarity to the CysG domain
  7. 710162Species Thermus thermophilus [TaxId:274] [142782] (2 PDB entries)
  8. 710164Domain d1va0b1: 1va0 B:2-226 [119900]
    automatically matched to 1V9A A:2-226
    complexed with cl, edo

Details for d1va0b1

PDB Entry: 1va0 (more details), 1.97 Å

PDB Description: crystal structure of the native form of uroporphyrin iii c-methyl transferase from thermus thermophilus
PDB Compounds: (B:) Uroporphyrin-III C-methyltransferase

SCOP Domain Sequences for d1va0b1:

Sequence, based on SEQRES records: (download)

>d1va0b1 c.90.1.1 (B:2-226) Hypothetical protein TTHA0667 {Thermus thermophilus [TaxId: 274]}
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek
qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl
plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre
ptlfverastpkerrvharleevaegkvevrppalwilgevvrvf

Sequence, based on observed residues (ATOM records): (download)

>d1va0b1 c.90.1.1 (B:2-226) Hypothetical protein TTHA0667 {Thermus thermophilus [TaxId: 274]}
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyveeihrlllr
harahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplthrglahg
faavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlfverast
pkerrvharleevaegkvevrppalwilgevvrvf

SCOP Domain Coordinates for d1va0b1:

Click to download the PDB-style file with coordinates for d1va0b1.
(The format of our PDB-style files is described here.)

Timeline for d1va0b1: