Lineage for d1va0b_ (1va0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911790Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2911791Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2911792Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2912005Protein automated matches [190790] (4 species)
    not a true protein
  7. 2912027Species Thermus thermophilus HB8 [TaxId:300852] [188045] (2 PDB entries)
  8. 2912030Domain d1va0b_: 1va0 B: [119900]
    automated match to d1v9aa1
    complexed with cl, edo

Details for d1va0b_

PDB Entry: 1va0 (more details), 1.97 Å

PDB Description: crystal structure of the native form of uroporphyrin iii c-methyl transferase from thermus thermophilus
PDB Compounds: (B:) Uroporphyrin-III C-methyltransferase

SCOPe Domain Sequences for d1va0b_:

Sequence, based on SEQRES records: (download)

>d1va0b_ c.90.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek
qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl
plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre
ptlfverastpkerrvharleevaegkvevrppalwilgevvrvfaekeapvdalal

Sequence, based on observed residues (ATOM records): (download)

>d1va0b_ c.90.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyveeihrlllr
harahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplthrglahg
faavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlfverast
pkerrvharleevaegkvevrppalwilgevvrvfaekeapvdalal

SCOPe Domain Coordinates for d1va0b_:

Click to download the PDB-style file with coordinates for d1va0b_.
(The format of our PDB-style files is described here.)

Timeline for d1va0b_: