SCOPe 2.07: Domain d1va0a_: 1va0 A:

Lineage for d1va0a_ (1va0 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
   Pfam PF00590

6. Protein automated matches [190790] (4 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [188045] (2 PDB entries)

8. Domain d1va0a_: 1va0 A: [119899]
   automated match to d1v9aa1
   complexed with cl, edo

Details for d1va0a_

PDB Entry: 1va0, 1.97 Å

PDB Description: crystal structure of the native form of uroporphyrin iii c-methyl transferase from thermus thermophilus

PDB Compounds: (A:) Uroporphyrin-III C-methyltransferase

SCOPe Domain Sequences for d1va0a_:

Sequence, based on SEQRES records:

>d1va0a_ c.90.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek
qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl
plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre
ptlfverastpkerrvharleevaegkvevrppalwilgevvrvf

Sequence, based on observed residues (ATOM records):

>d1va0a_ c.90.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeekqeei
hrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplth
rglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlf
verastpkerrvharleevaegkvevrppalwilgevvrvf

Timeline for d1va0a_:

• d1va0a_ first appeared in SCOP 1.73, called d1va0a1
  
• d1va0a_ appears in SCOPe 2.06
  
• d1va0a_ appears in the current release, SCOPe 2.08