Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) |
Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
Protein automated matches [190790] (4 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [188045] (2 PDB entries) |
Domain d1va0a_: 1va0 A: [119899] automated match to d1v9aa1 complexed with cl, edo |
PDB Entry: 1va0 (more details), 1.97 Å
SCOPe Domain Sequences for d1va0a_:
Sequence, based on SEQRES records: (download)
>d1va0a_ c.90.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre ptlfverastpkerrvharleevaegkvevrppalwilgevvrvf
>d1va0a_ c.90.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeekqeei hrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplth rglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlf verastpkerrvharleevaegkvevrppalwilgevvrvf
Timeline for d1va0a_: