SCOP 1.73: Domain d1v9va1: 1v9v A:8-108

Lineage for d1v9va1 (1v9v A:8-108)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.29: Bromodomain-like [47363] (10 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.10: MAST3 pre-PK domain-like [140482] (1 family)
   this domain precedes the Protein Kinase domain in Microtubule-associated serine/threonine-protein kinase 3 (MAST3)

5. Family a.29.10.1: MAST3 pre-PK domain-like [140483] (1 protein)

6. Protein Microtubule-associated serine/threonine-protein kinase 3, MAST3 (KIAA0561) [140484] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140485] (1 PDB entry)

8. Domain d1v9va1: 1v9v A:8-108 [119898]

Details for d1v9va1

PDB Entry: 1v9v

PDB Description: solution structure of putative domain of human kiaa0561 protein

PDB Compounds: (A:) KIAA0561 protein

SCOP Domain Sequences for d1v9va1:

Sequence; same for both SEQRES and ATOM records:

>d1v9va1 a.29.10.1 (A:8-108) Microtubule-associated serine/threonine-protein kinase 3, MAST3 (KIAA0561) {Human (Homo sapiens) [TaxId: 9606]}
pkataqmegrlqefltayapgarlaladgvlgfihhqivelardclaksgenlvtsryfl
emqeklerllqdahersdseevsfivqlvrklliiisrpar

Timeline for d1v9va1:

• d1v9va1 is new in SCOP 1.73
  
• d1v9va1 appears in SCOP 1.75
  
• d1v9va1 appears in the current release, SCOPe 2.08