![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.10: MAST3 pre-PK domain-like [140482] (1 family) ![]() this domain precedes the Protein Kinase domain in Microtubule-associated serine/threonine-protein kinase 3 (MAST3) automatically mapped to Pfam PF08926 |
![]() | Family a.29.10.1: MAST3 pre-PK domain-like [140483] (2 proteins) |
![]() | Protein Microtubule-associated serine/threonine-protein kinase 3, MAST3 (KIAA0561) [140484] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140485] (1 PDB entry) Uniprot O60307 181-281 |
![]() | Domain d1v9va1: 1v9v A:8-108 [119898] Other proteins in same PDB: d1v9va2, d1v9va3 |
PDB Entry: 1v9v (more details)
SCOPe Domain Sequences for d1v9va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v9va1 a.29.10.1 (A:8-108) Microtubule-associated serine/threonine-protein kinase 3, MAST3 (KIAA0561) {Human (Homo sapiens) [TaxId: 9606]} pkataqmegrlqefltayapgarlaladgvlgfihhqivelardclaksgenlvtsryfl emqeklerllqdahersdseevsfivqlvrklliiisrpar
Timeline for d1v9va1: