Lineage for d1v9va1 (1v9v A:8-108)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993306Superfamily a.29.10: MAST3 pre-PK domain-like [140482] (1 family) (S)
    this domain precedes the Protein Kinase domain in Microtubule-associated serine/threonine-protein kinase 3 (MAST3)
    automatically mapped to Pfam PF08926
  5. 1993307Family a.29.10.1: MAST3 pre-PK domain-like [140483] (2 protein domains)
  6. 1993308Protein Microtubule-associated serine/threonine-protein kinase 3, MAST3 (KIAA0561) [140484] (1 species)
  7. 1993309Species Human (Homo sapiens) [TaxId:9606] [140485] (1 PDB entry)
    Uniprot O60307 181-281
  8. 1993310Domain d1v9va1: 1v9v A:8-108 [119898]
    Other proteins in same PDB: d1v9va2, d1v9va3

Details for d1v9va1

PDB Entry: 1v9v (more details)

PDB Description: Solution structure of putative domain of human KIAA0561 protein
PDB Compounds: (A:) KIAA0561 protein

SCOPe Domain Sequences for d1v9va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9va1 a.29.10.1 (A:8-108) Microtubule-associated serine/threonine-protein kinase 3, MAST3 (KIAA0561) {Human (Homo sapiens) [TaxId: 9606]}
pkataqmegrlqefltayapgarlaladgvlgfihhqivelardclaksgenlvtsryfl
emqeklerllqdahersdseevsfivqlvrklliiisrpar

SCOPe Domain Coordinates for d1v9va1:

Click to download the PDB-style file with coordinates for d1v9va1.
(The format of our PDB-style files is described here.)

Timeline for d1v9va1: