Lineage for d1v9sd_ (1v9s D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175015Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1175016Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1175017Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 1175316Protein automated matches [190074] (7 species)
    not a true protein
  7. 1175335Species Thermus thermophilus [TaxId:300852] [186795] (1 PDB entry)
  8. 1175338Domain d1v9sd_: 1v9s D: [119897]
    Other proteins in same PDB: d1v9sa1
    automated match to d1i5ea_
    complexed with so4

Details for d1v9sd_

PDB Entry: 1v9s (more details), 2.1 Å

PDB Description: Crystal structure of TT0130 protein from Thermus thermophilus HB8
PDB Compounds: (D:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1v9sd_:

Sequence, based on SEQRES records: (download)

>d1v9sd_ c.61.1.1 (D:) automated matches {Thermus thermophilus [TaxId: 300852]}
mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
arvkvlsgkklalvailraglvmvegilklvpharvghiglyrdpeslnpvqyyiklppd
iaerraflldpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvv
aaiderlndhgyivpglgdagdriygtk

Sequence, based on observed residues (ATOM records): (download)

>d1v9sd_ c.61.1.1 (D:) automated matches {Thermus thermophilus [TaxId: 300852]}
mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
arvkvlsgkklalvailraglvmvegilklvpharvghiglyyiklppdiaerraflldp
mlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvvaaiderlndhg
yivpglgdagdriygtk

SCOPe Domain Coordinates for d1v9sd_:

Click to download the PDB-style file with coordinates for d1v9sd_.
(The format of our PDB-style files is described here.)

Timeline for d1v9sd_: