![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein automated matches [190074] (13 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [186795] (1 PDB entry) |
![]() | Domain d1v9sc_: 1v9s C: [119896] Other proteins in same PDB: d1v9sa1 automated match to d1i5ea_ complexed with so4 |
PDB Entry: 1v9s (more details), 2.1 Å
SCOPe Domain Sequences for d1v9sc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v9sc_ c.61.1.1 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap arvkvlsgkklalvailraglvmvegilklvpharvghiglyrdpeslnpvqyyiklppd iaerraflldpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvv aaiderlndhgyivpglgdagdriygtk
Timeline for d1v9sc_: