SCOPe 2.01: Domain d1v9sc_: 1v9s C:

Lineage for d1v9sc_ (1v9s C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein automated matches [190074] (7 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [186795] (1 PDB entry)

8. Domain d1v9sc_: 1v9s C: [119896]
   Other proteins in same PDB: d1v9sa1
   automated match to d1i5ea_
   complexed with so4

Details for d1v9sc_

PDB Entry: 1v9s, 2.1 Å

PDB Description: Crystal structure of TT0130 protein from Thermus thermophilus HB8

PDB Compounds: (C:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1v9sc_:

Sequence; same for both SEQRES and ATOM records:

>d1v9sc_ c.61.1.1 (C:) automated matches {Thermus thermophilus [TaxId: 300852]}
mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
arvkvlsgkklalvailraglvmvegilklvpharvghiglyrdpeslnpvqyyiklppd
iaerraflldpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvv
aaiderlndhgyivpglgdagdriygtk

Timeline for d1v9sc_:

• d1v9sc_ first appeared in SCOP 1.73, called d1v9sc1
  
• d1v9sc_ was called d1v9sc1 in SCOP 1.75
  
• d1v9sc_ appears in SCOPe 2.02
  
• d1v9sc_ appears in the current release, SCOPe 2.08