Lineage for d1v9sc1 (1v9s C:1-208)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703952Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 703953Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 703954Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)
  6. 704157Protein Uracil PRTase, Upp [53293] (5 species)
  7. 704187Species Thermus thermophilus [TaxId:274] [142554] (1 PDB entry)
  8. 704190Domain d1v9sc1: 1v9s C:1-208 [119896]
    automatically matched to 1V9S A:1-208
    complexed with so4

Details for d1v9sc1

PDB Entry: 1v9s (more details), 2.1 Å

PDB Description: Crystal structure of TT0130 protein from Thermus thermophilus HB8
PDB Compounds: (C:) uracil phosphoribosyltransferase

SCOP Domain Sequences for d1v9sc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9sc1 c.61.1.1 (C:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]}
mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
arvkvlsgkklalvailraglvmvegilklvpharvghiglyrdpeslnpvqyyiklppd
iaerraflldpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvv
aaiderlndhgyivpglgdagdriygtk

SCOP Domain Coordinates for d1v9sc1:

Click to download the PDB-style file with coordinates for d1v9sc1.
(The format of our PDB-style files is described here.)

Timeline for d1v9sc1: