![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (2 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins) |
![]() | Protein Uracil PRTase, Upp [53293] (5 species) |
![]() | Species Thermus thermophilus [TaxId:274] [142554] (1 PDB entry) |
![]() | Domain d1v9sb1: 1v9s B:1-208 [119895] automatically matched to 1V9S A:1-208 complexed with so4 |
PDB Entry: 1v9s (more details), 2.1 Å
SCOP Domain Sequences for d1v9sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v9sb1 c.61.1.1 (B:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap arvkvlsgkklalvailraglvmvegilklvpharvghiglyrdpeslnpvqyyiklppd iaerraflldpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvv aaiderlndhgyivpglgdagdriygtk
Timeline for d1v9sb1: