SCOP 1.73: Domain d1v9aa1: 1v9a A:2-226

Lineage for d1v9aa1 (1v9a A:2-226)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (7 proteins)
   Pfam PF00590

6. Protein Hypothetical protein TTHA0667 [142781] (1 species)
   strong sequence similarity to the CysG domain

7. Species Thermus thermophilus [TaxId:274] [142782] (2 PDB entries)

8. Domain d1v9aa1: 1v9a A:2-226 [119885]
   complexed with flc, sah

Details for d1v9aa1

PDB Entry: 1v9a, 2 Å

PDB Description: Crystal structure of Uroporphyrin-III C-methyl transferase from Thermus thermophilus complexed with S-adenyl homocysteine

PDB Compounds: (A:) Uroporphyrin-III C-methyltransferase

SCOP Domain Sequences for d1v9aa1:

Sequence, based on SEQRES records:

>d1v9aa1 c.90.1.1 (A:2-226) Hypothetical protein TTHA0667 {Thermus thermophilus [TaxId: 274]}
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek
qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl
plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre
ptlfverastpkerrvharleevaegkvevrppalwilgevvrvf

Sequence, based on observed residues (ATOM records):

>d1v9aa1 c.90.1.1 (A:2-226) Hypothetical protein TTHA0667 {Thermus thermophilus [TaxId: 274]}
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkkqeeihr
lllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplthrg
lahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlfve
rastpkerrvharleevaegkvevrppalwilgevvrvf

Timeline for d1v9aa1:

• d1v9aa1 is new in SCOP 1.73
  
• d1v9aa1 appears in SCOP 1.75
  
• d1v9aa1 appears in the current release, SCOPe 2.08