Lineage for d1v9aa1 (1v9a A:2-226)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911790Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2911791Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2911792Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2911962Protein Hypothetical protein TTHA0667 [142781] (1 species)
    strong sequence similarity to the CysG domain
  7. 2911963Species Thermus thermophilus [TaxId:274] [142782] (1 PDB entry)
    Uniprot Q5SKH6 2-226
  8. 2911964Domain d1v9aa1: 1v9a A:2-226 [119885]
    Other proteins in same PDB: d1v9ab_
    complexed with flc, sah

Details for d1v9aa1

PDB Entry: 1v9a (more details), 2 Å

PDB Description: Crystal structure of Uroporphyrin-III C-methyl transferase from Thermus thermophilus complexed with S-adenyl homocysteine
PDB Compounds: (A:) Uroporphyrin-III C-methyltransferase

SCOPe Domain Sequences for d1v9aa1:

Sequence, based on SEQRES records: (download)

>d1v9aa1 c.90.1.1 (A:2-226) Hypothetical protein TTHA0667 {Thermus thermophilus [TaxId: 274]}
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek
qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl
plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre
ptlfverastpkerrvharleevaegkvevrppalwilgevvrvf

Sequence, based on observed residues (ATOM records): (download)

>d1v9aa1 c.90.1.1 (A:2-226) Hypothetical protein TTHA0667 {Thermus thermophilus [TaxId: 274]}
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkkqeeihr
lllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplthrg
lahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlfve
rastpkerrvharleevaegkvevrppalwilgevvrvf

SCOPe Domain Coordinates for d1v9aa1:

Click to download the PDB-style file with coordinates for d1v9aa1.
(The format of our PDB-style files is described here.)

Timeline for d1v9aa1: