![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
![]() | Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) ![]() |
![]() | Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
![]() | Protein Hypothetical protein TTHA0667 [142781] (1 species) strong sequence similarity to the CysG domain |
![]() | Species Thermus thermophilus [TaxId:274] [142782] (1 PDB entry) Uniprot Q5SKH6 2-226 |
![]() | Domain d1v9aa1: 1v9a A:2-226 [119885] Other proteins in same PDB: d1v9ab_ complexed with flc, sah |
PDB Entry: 1v9a (more details), 2 Å
SCOPe Domain Sequences for d1v9aa1:
Sequence, based on SEQRES records: (download)
>d1v9aa1 c.90.1.1 (A:2-226) Hypothetical protein TTHA0667 {Thermus thermophilus [TaxId: 274]} grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre ptlfverastpkerrvharleevaegkvevrppalwilgevvrvf
>d1v9aa1 c.90.1.1 (A:2-226) Hypothetical protein TTHA0667 {Thermus thermophilus [TaxId: 274]} grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkkqeeihr lllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplthrg lahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlfve rastpkerrvharleevaegkvevrppalwilgevvrvf
Timeline for d1v9aa1: