![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.120.1: PIN domain-like [88723] (2 families) ![]() |
![]() | Family c.120.1.1: PIN domain [89619] (7 proteins) Pfam PF01850 |
![]() | Protein Hypothetical protein PH0500 [142112] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [142113] (2 PDB entries) |
![]() | Domain d1v96b1: 1v96 B:2-145 [119878] automatically matched to 1V96 A:2-149 complexed with gol |
PDB Entry: 1v96 (more details), 1.75 Å
SCOP Domain Sequences for d1v96b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v96b1 c.120.1.1 (B:2-145) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 53953]} plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye pirrfgldtmpldkfikevelmve
Timeline for d1v96b1: