Lineage for d1v96b1 (1v96 B:2-145)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712940Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 712941Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 712942Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 712980Protein Hypothetical protein PH0500 [142112] (1 species)
  7. 712981Species Pyrococcus horikoshii [TaxId:53953] [142113] (2 PDB entries)
  8. 712983Domain d1v96b1: 1v96 B:2-145 [119878]
    automatically matched to 1V96 A:2-149
    complexed with gol

Details for d1v96b1

PDB Entry: 1v96 (more details), 1.75 Å

PDB Description: Crystal structure of hypothetical protein of unknown function from pyrococcus horikoshii OT3
PDB Compounds: (B:) hypothetical protein PH0500

SCOP Domain Sequences for d1v96b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v96b1 c.120.1.1 (B:2-145) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 53953]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye
pirrfgldtmpldkfikevelmve

SCOP Domain Coordinates for d1v96b1:

Click to download the PDB-style file with coordinates for d1v96b1.
(The format of our PDB-style files is described here.)

Timeline for d1v96b1: