SCOPe 2.08: Domain d1v96b_: 1v96 B:

Lineage for d1v96b_ (1v96 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (4 families)

5. Family c.120.1.1: PIN domain [89619] (7 proteins)
   Pfam PF01850

6. Protein Hypothetical protein PH0500 [142112] (2 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [142113] (2 PDB entries)
   Uniprot O58236 2-149

8. Domain d1v96b_: 1v96 B: [119878]
   automated match to d1v96a1
   complexed with gol

Details for d1v96b_

PDB Entry: 1v96, 1.75 Å

PDB Description: Crystal structure of hypothetical protein of unknown function from pyrococcus horikoshii OT3

PDB Compounds: (B:) hypothetical protein PH0500

SCOPe Domain Sequences for d1v96b_:

Sequence; same for both SEQRES and ATOM records:

>d1v96b_ c.120.1.1 (B:) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 53953]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye
pirrfgldtmpldkfikevelmve

Timeline for d1v96b_:

• d1v96b_ first appeared in SCOP 1.73, called d1v96b1
  
• d1v96b_ appears in SCOPe 2.07