Lineage for d1v96a1 (1v96 A:2-149)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921858Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2921859Superfamily c.120.1: PIN domain-like [88723] (4 families) (S)
  5. 2921860Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 2921898Protein Hypothetical protein PH0500 [142112] (2 species)
  7. 2921899Species Pyrococcus horikoshii [TaxId:53953] [142113] (2 PDB entries)
    Uniprot O58236 2-149
  8. 2921900Domain d1v96a1: 1v96 A:2-149 [119877]
    complexed with gol

Details for d1v96a1

PDB Entry: 1v96 (more details), 1.75 Å

PDB Description: Crystal structure of hypothetical protein of unknown function from pyrococcus horikoshii OT3
PDB Compounds: (A:) hypothetical protein PH0500

SCOPe Domain Sequences for d1v96a1:

Sequence, based on SEQRES records: (download)

>d1v96a1 c.120.1.1 (A:2-149) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 53953]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye
pirrfgldtmpldkfikevelmvekeli

Sequence, based on observed residues (ATOM records): (download)

>d1v96a1 c.120.1.1 (A:2-149) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 53953]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltarlkknieaefeil
kdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkryepi
rrfgldtmpldkfikevelmvekeli

SCOPe Domain Coordinates for d1v96a1:

Click to download the PDB-style file with coordinates for d1v96a1.
(The format of our PDB-style files is described here.)

Timeline for d1v96a1: