Lineage for d1v8zd_ (1v8z D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139947Protein Tryptophan synthase, beta-subunit [53688] (4 species)
  7. 2139953Species Pyrococcus furiosus [TaxId:2261] [142741] (2 PDB entries)
    Uniprot Q8U093 1-386
  8. 2139957Domain d1v8zd_: 1v8z D: [119876]
    automated match to d2tysb_
    complexed with na, plp

Details for d1v8zd_

PDB Entry: 1v8z (more details), 2.21 Å

PDB Description: X-ray crystal structure of the Tryptophan Synthase b2 Subunit from Hyperthermophile, Pyrococcus furiosus
PDB Compounds: (D:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d1v8zd_:

Sequence, based on SEQRES records: (download)

>d1v8zd_ c.79.1.1 (D:) Tryptophan synthase, beta-subunit {Pyrococcus furiosus [TaxId: 2261]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvsg

Sequence, based on observed residues (ATOM records): (download)

>d1v8zd_ c.79.1.1 (D:) Tryptophan synthase, beta-subunit {Pyrococcus furiosus [TaxId: 2261]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlvsg

SCOPe Domain Coordinates for d1v8zd_:

Click to download the PDB-style file with coordinates for d1v8zd_.
(The format of our PDB-style files is described here.)

Timeline for d1v8zd_: