Lineage for d1v8zb_ (1v8z B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1006039Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1006040Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1006041Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1006203Protein Tryptophan synthase, beta-subunit [53688] (2 species)
  7. 1006204Species Pyrococcus furiosus [TaxId:2261] [142741] (2 PDB entries)
    Uniprot Q8U093 1-386
  8. 1006206Domain d1v8zb_: 1v8z B: [119874]
    automated match to d2tysb_
    complexed with na, plp

Details for d1v8zb_

PDB Entry: 1v8z (more details), 2.21 Å

PDB Description: X-ray crystal structure of the Tryptophan Synthase b2 Subunit from Hyperthermophile, Pyrococcus furiosus
PDB Compounds: (B:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d1v8zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8zb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Pyrococcus furiosus [TaxId: 2261]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvsgn

SCOPe Domain Coordinates for d1v8zb_:

Click to download the PDB-style file with coordinates for d1v8zb_.
(The format of our PDB-style files is described here.)

Timeline for d1v8zb_: