Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
Protein Tryptophan synthase, beta-subunit [53688] (2 species) |
Species Pyrococcus furiosus [TaxId:2261] [142741] (2 PDB entries) Uniprot Q8U093 1-386 |
Domain d1v8zb_: 1v8z B: [119874] automated match to d2tysb_ complexed with na, plp |
PDB Entry: 1v8z (more details), 2.21 Å
SCOPe Domain Sequences for d1v8zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8zb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Pyrococcus furiosus [TaxId: 2261]} mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem srdeiiivnlsgrgdkdldivlkvsgn
Timeline for d1v8zb_: