SCOP 1.75: Domain d1v8zb1: 1v8z B:1-386

Lineage for d1v8zb1 (1v8z B:1-386)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (2 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [142741] (2 PDB entries)
   Uniprot Q8U093 1-386

8. Domain d1v8zb1: 1v8z B:1-386 [119874]
   automatically matched to 1V8Z A:1-386
   complexed with na, plp

Details for d1v8zb1

PDB Entry: 1v8z, 2.21 Å

PDB Description: X-ray crystal structure of the Tryptophan Synthase b2 Subunit from Hyperthermophile, Pyrococcus furiosus

PDB Compounds: (B:) Tryptophan synthase beta chain 1

SCOP Domain Sequences for d1v8zb1:

Sequence; same for both SEQRES and ATOM records:

>d1v8zb1 c.79.1.1 (B:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvsg

Timeline for d1v8zb1:

• d1v8zb1 first appeared in SCOP 1.73
  
• d1v8zb1 is called d1v8zb_ in SCOPe 2.01
  
• d1v8zb1 appears in the current release, SCOPe 2.08, called d1v8zb_