SCOPe 2.08: Domain d1v8hb_: 1v8h B:

Lineage for d1v8hb_ (1v8h B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.19: SoxZ-like [141027] (1 protein)
   automatically mapped to Pfam PF08770

6. Protein Sulfur oxidation protein SoxZ [141028] (1 species)

7. Species Thermus thermophilus [TaxId:274] [141029] (1 PDB entry)
   Uniprot Q5SME6 2-107
   TTHA1420

8. Domain d1v8hb_: 1v8h B: [119871]
   automated match to d1v8ha1

Details for d1v8hb_

PDB Entry: 1v8h, 1.2 Å

PDB Description: Crystal structure of TT0351 protein from Thermus thermophilus HB8

PDB Compounds: (B:) sulfur oxidation protein SoxZ

SCOPe Domain Sequences for d1v8hb_:

Sequence; same for both SEQRES and ATOM records:

>d1v8hb_ b.1.18.19 (B:) Sulfur oxidation protein SoxZ {Thermus thermophilus [TaxId: 274]}
pfrtiarlnpakpkageefrlqvvaqhpnepgtrrdaegklipakyinlvevyfegekva
earpgpstsanplyafkfkaekagtftiklkdtdgdtgeasvklel

Timeline for d1v8hb_:

• d1v8hb_ first appeared in SCOP 1.73, called d1v8hb1
  
• d1v8hb_ appears in SCOPe 2.07