Lineage for d1v8hb_ (1v8h B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765974Family b.1.18.19: SoxZ-like [141027] (1 protein)
    automatically mapped to Pfam PF08770
  6. 2765975Protein Sulfur oxidation protein SoxZ [141028] (1 species)
  7. 2765976Species Thermus thermophilus [TaxId:274] [141029] (1 PDB entry)
    Uniprot Q5SME6 2-107
    TTHA1420
  8. 2765978Domain d1v8hb_: 1v8h B: [119871]
    automated match to d1v8ha1

Details for d1v8hb_

PDB Entry: 1v8h (more details), 1.2 Å

PDB Description: Crystal structure of TT0351 protein from Thermus thermophilus HB8
PDB Compounds: (B:) sulfur oxidation protein SoxZ

SCOPe Domain Sequences for d1v8hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8hb_ b.1.18.19 (B:) Sulfur oxidation protein SoxZ {Thermus thermophilus [TaxId: 274]}
pfrtiarlnpakpkageefrlqvvaqhpnepgtrrdaegklipakyinlvevyfegekva
earpgpstsanplyafkfkaekagtftiklkdtdgdtgeasvklel

SCOPe Domain Coordinates for d1v8hb_:

Click to download the PDB-style file with coordinates for d1v8hb_.
(The format of our PDB-style files is described here.)

Timeline for d1v8hb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v8ha1