Lineage for d1v8ea1 (1v8e A:8-224)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2101609Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2101665Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins)
    Pfam PF03009
  6. 2101680Protein Putative glycerophosphodiester phosphodiesterase TTHB141 [141864] (1 species)
  7. 2101681Species Thermus thermophilus [TaxId:274] [141865] (1 PDB entry)
    Uniprot Q53W25 8-224
  8. 2101682Domain d1v8ea1: 1v8e A:8-224 [119869]

Details for d1v8ea1

PDB Entry: 1v8e (more details), 1.5 Å

PDB Description: Crystal Structure of Glycerophosphoryl Diester Phosphodiesterase from Thermus thermophilus HB8
PDB Compounds: (A:) putative glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d1v8ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8ea1 c.1.18.3 (A:8-224) Putative glycerophosphodiester phosphodiesterase TTHB141 {Thermus thermophilus [TaxId: 274]}
plrlghrgaplkakentlesfrlaleagldgveldvwptrdgvfavrhdpdtplgpvfqv
dyadlkaqepdlprleevlalkeafpqavfnvelksfpglgeeaarrlaallrgregvwv
ssfdplallalrkaapglplgflmaedhsallpclgveavhphhalvteeavagwrkrgl
fvvawtvneegearrllalgldgligdrpevllplgg

SCOPe Domain Coordinates for d1v8ea1:

Click to download the PDB-style file with coordinates for d1v8ea1.
(The format of our PDB-style files is described here.)

Timeline for d1v8ea1: