![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) ![]() |
![]() | Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins) Pfam PF03009 |
![]() | Protein Putative glycerophosphodiester phosphodiesterase TTHB141 [141864] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [141865] (1 PDB entry) Uniprot Q53W25 8-224 |
![]() | Domain d1v8ea1: 1v8e A:8-224 [119869] |
PDB Entry: 1v8e (more details), 1.5 Å
SCOPe Domain Sequences for d1v8ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8ea1 c.1.18.3 (A:8-224) Putative glycerophosphodiester phosphodiesterase TTHB141 {Thermus thermophilus [TaxId: 274]} plrlghrgaplkakentlesfrlaleagldgveldvwptrdgvfavrhdpdtplgpvfqv dyadlkaqepdlprleevlalkeafpqavfnvelksfpglgeeaarrlaallrgregvwv ssfdplallalrkaapglplgflmaedhsallpclgveavhphhalvteeavagwrkrgl fvvawtvneegearrllalgldgligdrpevllplgg
Timeline for d1v8ea1: