Lineage for d1v7ya1 (1v7y A:1-268)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079595Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2079596Species Escherichia coli [TaxId:562] [117360] (3 PDB entries)
    Uniprot P00928
  8. 2079599Domain d1v7ya1: 1v7y A:1-268 [119865]
    Other proteins in same PDB: d1v7yb_
    complexed with so4

Details for d1v7ya1

PDB Entry: 1v7y (more details), 2.5 Å

PDB Description: Crystal structure of tryptophan synthase alpha-subunit from Escherichia coli at room temperature
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d1v7ya1:

Sequence, based on SEQRES records: (download)

>d1v7ya1 c.1.2.4 (A:1-268) Trp synthase alpha-subunit {Escherichia coli [TaxId: 562]}
meryeslfaqlkerkegafvpfvtlgdpgieqslkiidtlieagadalelgipfsdplad
gptiqnatlrafaagvtpaqcfemlalirqkhptipigllmyanlvfnkgidefyaqcek
vgvdsvlvadvpveesapfrqaalrhnvapificppnadddllrqiasygrgytyllsra
gvtgaenraalplnhlvaklkeynaapplqgfgisapdqvkaaidagaagaisgsaivki
ieqhinepekmlaalkvfvqpmkaatrs

Sequence, based on observed residues (ATOM records): (download)

>d1v7ya1 c.1.2.4 (A:1-268) Trp synthase alpha-subunit {Escherichia coli [TaxId: 562]}
meryeslfaqlkerkegafvpfvtlgdpgieqslkiidtlieagadalelgipfatlraf
aagvtpaqcfemlalirqkhptipigllmyanlvfnkgidefyaqcekvgvdsvlvadvp
veesapfrqaalrhnvapificppnadddllrqiasygrgytyllsragalplnhlvakl
keynaapplqgfgisapdqvkaaidagaagaisgsaivkiieqhinepekmlaalkvfvq
pmkaatrs

SCOPe Domain Coordinates for d1v7ya1:

Click to download the PDB-style file with coordinates for d1v7ya1.
(The format of our PDB-style files is described here.)

Timeline for d1v7ya1: