Lineage for d1v5zb_ (1v5z B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423301Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 1423302Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 1423303Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 1423304Protein Flavin reductase P (NADPH:FMN oxidoreductase) [55473] (2 species)
  7. 1423305Species Vibrio fischeri [TaxId:668] [55475] (3 PDB entries)
  8. 1423311Domain d1v5zb_: 1v5z B: [119858]
    automated match to d1vfra_
    complexed with 2hc, fmn

Details for d1v5zb_

PDB Entry: 1v5z (more details), 2 Å

PDB Description: Binding of coumarins to NAD(P)H:FMN oxidoreductase
PDB Compounds: (B:) Major NAD(P)H-flavin oxidoreductase

SCOPe Domain Sequences for d1v5zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5zb_ d.90.1.1 (B:) Flavin reductase P (NADPH:FMN oxidoreductase) {Vibrio fischeri [TaxId: 668]}
thpiihdlenrytskkydpskkvsqedlavllealrlsassinsqpwkfiviesdaakqr
mhdsfanmhqfnqphikacshvilfanklsytrddydvvlskavadkriteeqkeaafas
fkfvelncdengehkawtkpqaylalgnalhtlarlnidsttmegidpellseifadelk
gyechvalaigyhhpsedynaslpksrkafedvitil

SCOPe Domain Coordinates for d1v5zb_:

Click to download the PDB-style file with coordinates for d1v5zb_.
(The format of our PDB-style files is described here.)

Timeline for d1v5zb_: