Lineage for d1v5ra1 (1v5r A:8-91)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568896Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2569007Superfamily d.82.4: GAS2 domain-like [143575] (1 family) (S)
    this superfamily may include the most C-terminal domain of IBP39 (103410); the preceeding (middle) domain of IBP39 may be split and reassigned to the EF-hand superfamily (47473)
    automatically mapped to Pfam PF02187
  5. 2569008Family d.82.4.1: GAS2 domain [143576] (1 protein)
    Pfam PF02187
  6. 2569009Protein Growth-arrest-specific protein 2, GAS2 [143577] (1 species)
  7. 2569010Species Mouse (Mus musculus) [TaxId:10090] [143578] (1 PDB entry)
    Uniprot P11862 200-284
  8. 2569011Domain d1v5ra1: 1v5r A:8-91 [119854]
    Other proteins in same PDB: d1v5ra2, d1v5ra3
    complexed with zn

Details for d1v5ra1

PDB Entry: 1v5r (more details)

PDB Description: solution structure of the gas2 domain of the growth arrest specific 2 protein
PDB Compounds: (A:) Growth-arrest-specific protein 2

SCOPe Domain Sequences for d1v5ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ra1 d.82.4.1 (A:8-91) Growth-arrest-specific protein 2, GAS2 {Mouse (Mus musculus) [TaxId: 10090]}
nllddavkrisedppckcptkfcverlsqgryrvgekilfirmlhnkhvmvrvgggwetf
agyllkhdpcrmlqisrvdgktsp

SCOPe Domain Coordinates for d1v5ra1:

Click to download the PDB-style file with coordinates for d1v5ra1.
(The format of our PDB-style files is described here.)

Timeline for d1v5ra1: