![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
![]() | Superfamily d.82.4: GAS2 domain-like [143575] (1 family) ![]() this superfamily may include the most C-terminal domain of IBP39 (103410); the preceeding (middle) domain of IBP39 may be split and reassigned to the EF-hand superfamily (47473) automatically mapped to Pfam PF02187 |
![]() | Family d.82.4.1: GAS2 domain [143576] (1 protein) Pfam PF02187 |
![]() | Protein Growth-arrest-specific protein 2, GAS2 [143577] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [143578] (1 PDB entry) Uniprot P11862 200-284 |
![]() | Domain d1v5ra1: 1v5r A:8-91 [119854] Other proteins in same PDB: d1v5ra2, d1v5ra3 complexed with zn |
PDB Entry: 1v5r (more details)
SCOPe Domain Sequences for d1v5ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5ra1 d.82.4.1 (A:8-91) Growth-arrest-specific protein 2, GAS2 {Mouse (Mus musculus) [TaxId: 10090]} nllddavkrisedppckcptkfcverlsqgryrvgekilfirmlhnkhvmvrvgggwetf agyllkhdpcrmlqisrvdgktsp
Timeline for d1v5ra1: