![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
![]() | Protein Pyruvate oxidase [88754] (2 species) |
![]() | Species Aerococcus viridans [TaxId:1377] [142207] (4 PDB entries) |
![]() | Domain d1v5ga3: 1v5g A:364-592 [119852] Other proteins in same PDB: d1v5ga1, d1v5ga2 automatically matched to 1V5E A:364-592 complexed with fad, htl, mg |
PDB Entry: 1v5g (more details), 1.96 Å
SCOP Domain Sequences for d1v5ga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5ga3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} gdlqfyqvynainnhadedaiysidvgnstqtsirhlhmtpknmwrtsplfatmgiaipg glgakntypdrqvwniigdgafsmtypdvvtnvrynmpvinvvfsnteyafiknkyedtn knlfgvdftdvdyakiaeaqgakgftvsriedmdrvmaeavaankaghtvvidckitqdr pipvetlkldsklysedeikaykeryeaanlvpfreyleaegleskyik
Timeline for d1v5ga3: