Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (14 species) not a true protein |
Species Aerococcus viridans [TaxId:1377] [254914] (2 PDB entries) |
Domain d1v5ga1: 1v5g A:178-360 [119850] Other proteins in same PDB: d1v5ga2, d1v5ga3 automated match to d1poxa1 complexed with fad, htl, mg |
PDB Entry: 1v5g (more details), 1.96 Å
SCOPe Domain Sequences for d1v5ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5ga1 c.31.1.0 (A:178-360) automated matches {Aerococcus viridans [TaxId: 1377]} yssanslrkyapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvi ttgknfetfewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnf iqididpamlgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinm let
Timeline for d1v5ga1: