SCOP 1.73: Domain d1v5ga1: 1v5g A:187-363

Lineage for d1v5ga1 (1v5g A:187-363)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Pyruvate oxidase [52476] (2 species)
   binds FAD

7. Species Aerococcus viridans [TaxId:1377] [142122] (4 PDB entries)

8. Domain d1v5ga1: 1v5g A:187-363 [119850]
   Other proteins in same PDB: d1v5ga2, d1v5ga3
   automatically matched to 1V5E A:187-363
   complexed with fad, htl, mg

Details for d1v5ga1

PDB Entry: 1v5g, 1.96 Å

PDB Description: Crystal Structure of the Reaction Intermediate between Pyruvate oxidase containing FAD and TPP, and Substrate Pyruvate

PDB Compounds: (A:) Pyruvate oxidase

SCOP Domain Sequences for d1v5ga1:

Sequence; same for both SEQRES and ATOM records:

>d1v5ga1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]}
yapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvittgknfetf
ewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnfiqididpam
lgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinmletkee

Timeline for d1v5ga1:

• d1v5ga1 is new in SCOP 1.73
  
• d1v5ga1 appears in SCOP 1.75
  
• d1v5ga1 appears in the current release, SCOPe 2.08