Lineage for d1v5fa3 (1v5f A:361-592)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2473412Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2473413Protein automated matches [227126] (21 species)
    not a true protein
  7. 2473414Species Aerococcus viridans [TaxId:1377] [254913] (2 PDB entries)
  8. 2473416Domain d1v5fa3: 1v5f A:361-592 [119849]
    Other proteins in same PDB: d1v5fa1
    automated match to d1poxa3
    complexed with fad, mg, so4, tpp

Details for d1v5fa3

PDB Entry: 1v5f (more details), 1.8 Å

PDB Description: Crystal Structure of Pyruvate oxidase complexed with FAD and TPP, from Aerococcus viridans
PDB Compounds: (A:) Pyruvate oxidase

SCOPe Domain Sequences for d1v5fa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5fa3 c.36.1.0 (A:361-592) automated matches {Aerococcus viridans [TaxId: 1377]}
keegdlqfyqvynainnhadedaiysidvgnstqtsirhlhmtpknmwrtsplfatmgia
ipgglgakntypdrqvwniigdgafsmtypdvvtnvrynmpvinvvfsnteyafiknkye
dtnknlfgvdftdvdyakiaeaqgakgftvsriedmdrvmaeavaankaghtvvidckit
qdrpipvetlkldsklysedeikaykeryeaanlvpfreyleaegleskyik

SCOPe Domain Coordinates for d1v5fa3:

Click to download the PDB-style file with coordinates for d1v5fa3.
(The format of our PDB-style files is described here.)

Timeline for d1v5fa3: